PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3DS_72524290F.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 435aa    MW: 47644.9 Da    PI: 7.1295
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3DS_72524290F.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.23.2e-3761120362
                 zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                            + +++cprC+s++tkfCy+nny++sqPr+fC++C+ryWt+GG +rnvPvG+grr+nk++s
  Traes_3DS_72524290F.1  61 DIIVPCPRCNSMETKFCYFNNYNVSQPRHFCRNCQRYWTAGGNIRNVPVGSGRRRNKHAS 120
                            56789****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-2857117IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.26764118IPR003851Zinc finger, Dof-type
PfamPF027012.3E-3164118IPR003851Zinc finger, Dof-type
PROSITE patternPS01361066102IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MPCVSNKLLN VEATPFCSKN REQNDQAISK HGVEVRTGFK SEEIKTGSDG SGQDKVLKKP  60
DIIVPCPRCN SMETKFCYFN NYNVSQPRHF CRNCQRYWTA GGNIRNVPVG SGRRRNKHAS  120
HFRHAMMSCD ANIAAPGDVS NEIHHLALPL LPQVLPGPIK ENETVKEFGS QVPVCKPMSS  180
IHNIEEQKDT HLVSLASGDN SEEQSCPSPA TVSGCSENHT PDSAVKKEPS NVLGYYNGIT  240
LPHPHGPALV FPWSPGWNSI AVMAAAQCST EPIQGLENVK HGLPPWAPPL MMAAPGICTP  300
VVSFPMMPPP LWSCIPGWPN GMWSSPCPGS NGPPNKITCS EDNSPTLGKH SREADLQEED  360
RENNVQVPKT LRIDDPAETT KTSVRDTLGI KPDEKGMFEP FQMKVLKNDK TPESPQALQA  420
NPAAFSRSQS FQERT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565663.10.0PREDICTED: cyclic dof factor 2-like
TrEMBLM8C9680.0M8C968_AEGTA; Dof zinc finger protein
STRINGMLOC_79421.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.13e-57cycling DOF factor 3